PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01399.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 288aa    MW: 32652.8 Da    PI: 7.2058
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01399.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+eEd++l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Rsa1.0_01399.1_g00001.1 14 RGPWTPEEDQILISFIHKHGHSNWRALPKQAGLLRCGKSCRLRWMNYL 61
                             89******************************99************97 PP

2Myb_DNA-binding49.31.1e-1567112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+eE+  ++ +++ lG++ W++Ia++++ gRt++++k+ w+++l
  Rsa1.0_01399.1_g00001.1  67 RGNFTKEEEASIISLHQILGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.839961IPR017930Myb domain
SuperFamilySSF466891.69E-3011108IPR009057Homeodomain-like
SMARTSM007177.4E-151363IPR001005SANT/Myb domain
PfamPF002493.5E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-251568IPR009057Homeodomain-like
CDDcd001679.72E-121661No hitNo description
PROSITE profilePS5129424.07662116IPR017930Myb domain
SMARTSM007171.2E-1366114IPR001005SANT/Myb domain
PfamPF002492.9E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2669116IPR009057Homeodomain-like
CDDcd001671.15E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRAPCCEKM GLNRGPWTPE EDQILISFIH KHGHSNWRAL PKQAGLLRCG KSCRLRWMNY  60
LKPDIKRGNF TKEEEASIIS LHQILGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLEDYQ  120
PAKPKTSNKK KATKPKAQSL PTKLNSTRRE LELANSSNPS FESLFSASTS TSDAVSSVTL  180
MSHEGHNNEA KMDKKSGDIN IAYQDCCSFE NFGADIDESF WNQTLYSKDE SNYVLNLEAA  240
GLDEIQQEFQ QLDPVEKKMV FDSEMDFWFD VLARTGGEQD LLAGLLIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121175109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596435.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D3D5J70.0A0A0D3D5J7_BRAOL; Uncharacterized protein
STRINGBra014929.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-150myb domain protein 15